PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.U1K2F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 246aa    MW: 28034.2 Da    PI: 10.5028
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.U1K2FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.79.3e-27191238451
      G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  +rWtp+LH rFv+av++LGG+e+AtPk +l+lm++kgL ++hvkSHLQ
  Araip.U1K2F 191 MRWTPNLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLIITHVKSHLQ 238
                  89********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015573.3E-18191238IPR006447Myb domain, plants
SuperFamilySSF466891.79E-10191239IPR009057Homeodomain-like
PfamPF002491.3E-6191238IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-22191238IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MTVRELGLSD TVLDSLAQCF SRNTSEIKRY ESPSNVLYML DMKLLVMKTM LLGIPRMEIP  60
KIFLKVKSLF WKRILKQLLT PLTIFFVDAV LFSIANYMDV PRILSSSLRS NLWNPLDTEH  120
EPCGLNCFKL VLKLGRFFNA TSSAQADVEE KCSGSSLSRK KSFAKRYLGE TGQHMLGSNV  180
LPVPSLMLTF MRWTPNLHLR FVHAVQRLGG QERATPKLVL QLMNIKGLII THVKSHLQEQ  240
EGRGHK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-22G2-like family protein